DPCstruct | MC40445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 19.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.88 |
| Pfam Score | 91.77 |
| Assigned Pfam label(s) | PF06415- CL0021- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0ACY9 | 19-160 | QIEEELLEDTDPDEYEEPINPNFTGMFPYERGLNAESVFKKKVVENTLGEEIAEKGFTQLRVAESQKKPHVTYFFNGQRELKFEGEE… |
| A0A3P8KC69 | 148-287 | QLTHLFIGSKLYDNKPKHPVKISKYCSMMKYEGISTLVAFEEMEVSMPIGRVLEKAGKSQLRVAETQKYAHVTYFMDGGNDIEFKNS… |
| D8M448 | 45-230 | None |
| A0A5J4Z1I2 | 101-297 | None |
| A0A836AUN9 | 701-886 | None |
| A0A4Y7LDF0 | 281-452 | None |
| A0A446Q3K8 | 4-165 | None |
| A0A2G9ZM99 | 261-404 | None |
| A0A7V0STD3 | 35-176 | None |
| A0A509BMG4 | 45-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.