DPCstruct | MC40441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 17.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06853 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5ENK3 | 6-137 | QMQRLITQLAARWELDLAADEAHLKLENRSCVPLVIEKVGPTLVSVAHHVEENGDLSPDPEVLFFTGYGPWVPIEVARRPPAGYRAY… |
| A0A0S2TIS2 | 3-130 | IYERIYKNLDKLGVMQVLASGRRSARSEVSGVMNLHLDVVLEESSGVVRIALAHYFRQSGDLCCDPDMTIRIDQQHKVAEALTFQQA… |
| A0A7C7UVV6 | 3-117 | None |
| A0A831RWU4 | 7-127 | None |
| A0A1Y6AQM5 | 1-127 | None |
| A0A2E1NV60 | 13-177 | None |
| A0A2D7U3J9 | 7-144 | None |
| A0A2D3V376 | 54-172 | None |
| A0A1Y2CKW1 | 4-172 | None |
| A0A7K4E2E4 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.