DPCstruct | MC40440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 166 ± 18 aa |
| Standard deviation of domain lengths | 18.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 18.53 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF05565- PF07352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4WU80 | 1-147 | MEEAAEFVGRIGKEQREIDRIQNKLNEAVEKLKSKSMSESQVRNENISQLVEGLFIFAESHRKELTKNEKKKTIEFPTGIFGWRMTP… |
| A0A7U6JI57 | 9-172 | MALYEISNDYLKALDLFTDPEADIPLEAALDTLEGIEGQLQEKAVNVAKFMKNLDATAKAIKEAEQQMARRRKAIENRARWIKDYLK… |
| A0A2M6WYS3 | 4-174 | None |
| A0A350UIN8 | 11-207 | None |
| A0A0R2FP45 | 3-130 | None |
| A0A7V2XIG7 | 75-251 | None |
| A0A2D8J5J8 | 7-148 | None |
| A0A629K6E2 | 11-166 | None |
| A0A450YW58 | 1-171 | None |
| A0A2N1S8L5 | 4-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.