DPCstruct | MC4044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 203 ± 23 aa |
| Standard deviation of domain lengths | 22.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2MBT8 | 1-158 | MKPAPIEPGAAQERSFTRWVVIALFGQAVVCFLRLWFLWDIWGGFLMALTIMLGYCALRESLPVKLVCLWGVVNAILGAWDALTGLV… |
| A0A7S0FHW9 | 12-216 | SARFGNGPLHRHTMLLPLPSPPMQIGPPSEYARSRRPWMLVVLVLQSVTCILRIISLLDIMGGFIMLIMVAIGWYGWKEDMHITFIC… |
| A0A7S0ANT4 | 17-247 | None |
| A0A7S2IBE0 | 25-217 | None |
| A0A812Z364 | 9-221 | None |
| A0A812WG09 | 2-179 | None |
| A0A1Q9DLK7 | 364-590 | None |
| A0A7S2VKH7 | 2-194 | None |
| A0A1Q9C8C9 | 53-240 | None |
| A0A812XU16 | 376-601 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.