DPCstruct | MC40438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 13.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2MP47 | 1-99 | DLNETIKEKIEKIAENVYGADSVRYTKKADLAIKDLEDHDLDKKMICMAKTQYSLSDDPKKLGAPKNFSITVRDIKIANGAGFIIPL… |
| A0A097ATI5 | 4-91 | EGKNEYAPLYPLEMSLKEKIETIAREIYGADGVDYTPAANKEIENLENLGYGKLPICMAKTQYSLSDNPSLLGRPTNFKITVRNVKIS |
| A0A7V5E2Y4 | 105-223 | None |
| A0A5A9NF52 | 1162-1280 | None |
| A0A6G0XHM6 | 539-656 | None |
| A0A7C7W6G1 | 165-261 | None |
| A0A3D4ZYS0 | 434-526 | None |
| A0A7J6SQD3 | 225-340 | None |
| A0A6U0RF96 | 71-176 | None |
| A0A7V6DNH7 | 127-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.