DPCstruct | MC40436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 174 ± 29 aa |
| Standard deviation of domain lengths | 28.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | CL0063- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1EAZ1 | 8-182 | NGLRPVKGVRIGAHTSIDELMTGLRSSAFGAGRLAKAVDIFTEMQTEETTKFMGVAGALVPAGMRTILAELIRDRYVDVVVTTGANL… |
| F2L2T0 | 2-152 | KEVIDVYRKIGGFQALHVVEAADILKEAVRNADLRFFSFTANLVATGLREIIADAIRRGLFNVVVTTAGALDHDIAKAEGARYVPAS… |
| M0A4L7 | 5-94 | None |
| A0A835NCY9 | 3-135 | None |
| A0A7J6BCL8 | 139-327 | None |
| A0A7J6Q6W5 | 17-148 | None |
| R7QGB8 | 21-177 | None |
| A0A497EWT7 | 5-117 | None |
| A0A811K9F7 | 9-198 | None |
| B7XK19 | 10-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.