DPCstruct | MC40431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Standard deviation of domain lengths | 19.09 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2YXF4 | 139-213 | FDWQLTDSIDTIAGYPVQMATTDFGGRSWIAWFSPEIPFNDGPYKFNGLPGLIVKVYDTRMHYVFELKDIEKPDH |
| A0A2M7QI82 | 13-104 | AIKAEGSYYHPVTNEDLKVVAWYIPSIQLQSGPDIFMGLPGLIAEVDLKGAIVTIKKIETIKNLEIEKINDLKAMNQQEFKDLIKSL… |
| A0A3A9VJ48 | 165-271 | None |
| A0A4P8E7C9 | 20-140 | None |
| A0A348XYQ1 | 38-172 | None |
| A0A1M5LDG8 | 3-107 | None |
| A0A1U7PWM9 | 121-189 | None |
| A0A357BCZ3 | 30-158 | None |
| A0A5A8AG31 | 21-105 | None |
| A0A086F4A1 | 9-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.