DPCstruct | MC4043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 164 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 81.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812UR87 | 221-385 | SKWVPRRIKHNAFVLSLWACVWLLGTYPLGRPLSEGWRFMFTVSFFARIGYSAAWMFITNFTHSLPWNEFLAQDPGRTWPVLHNVMA… |
| A0A7S0FDH1 | 1-173 | YTKWFWQRLKHHLFLFALWGGVWLLGTYPLGRPLSEGWRVLLPVTVAARCGFASAWMVFTNFNHSHMWNRFLARAPERNYPLMTLVM… |
| A0A1Q9EMS6 | 172-336 | None |
| A0A812QU93 | 132-296 | None |
| A0A7S2C8Z4 | 348-515 | None |
| A0A812TDX6 | 284-450 | None |
| A0A812UVY3 | 288-452 | None |
| A0A812WK92 | 106-270 | None |
| A0A812PCN5 | 1-143 | None |
| A0A812YA71 | 84-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.