DPCstruct | MC40427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 132 ± 9 aa |
| Standard deviation of domain lengths | 8.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7LMX6 | 8-131 | GWILTGTTVAFVTAVYVPCVQRTVPGGDSGELITTACELGVAHPPGYPVFTLLARLSIYLLPSLSPAHSVNLMCSLLGAAACGCFTL… |
| A0A1W9LIQ5 | 2-131 | FFLVFNSTFIIYLYTMYPTISPYRDSGDMIVSAFTLGIAHPPGYPLYVLLGKVFTILIPFGNIAYRVNLLSAFFGAAACGVLYLLIK… |
| A0A202DGX2 | 25-173 | None |
| A0A2V6GU62 | 11-129 | None |
| A0A3R6WSV8 | 13-142 | None |
| A0A3M0JCN7 | 19-145 | None |
| A0A1C5WLJ3 | 7-145 | None |
| A0A6G0K7G1 | 39-165 | None |
| A0A847IRB4 | 9-144 | None |
| A0A660YS16 | 6-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.