DPCstruct | MC40425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4ZYZ5 | 213-281 | TQMVAGDPCSETCGMKALASYVRNGEHLQRMDKSCVEEMPEFDLKTPEYYLQSVMGTDDAYDGVFNSSL |
| A0A6A3HRK0 | 284-356 | HGALAWTMMDSGTTCGMKILASYVSSEGKLKGLDKSCVGEMPVFDLTVSTDYQANFFSTDDVYDGAFNSSLSS |
| W2KGG8 | 56-116 | None |
| W2FXL3 | 140-240 | None |
| W2YE09 | 289-387 | None |
| A0A0W8CDV9 | 203-286 | None |
| G4ZXS9 | 568-652 | None |
| A0A080Z5F3 | 78-156 | None |
| A0A329SEJ0 | 11-98 | None |
| A0A329SJA1 | 110-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.