DPCstruct | MC40424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 423 ± 45 aa |
| Standard deviation of domain lengths | 44.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 52.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4ZUX9 | 58-529 | LLLFTATDYLADATFLIEVDRSFFLYTQRDLSMAGSCTDCEALTSLPGFSALVGHPPTESLYDFSTLSGEAIALGEELDNSGAICQS… |
| G4YRL5 | 67-550 | LLIFTSTNYMNGAAFFIESKDSYFAFNERDLVMTGGCTGCHIPCRRAMFLLNTFNHEALKSKPMFEDLYTATTWDYSVLSAEALALG… |
| A0A3F2RPY9 | 18-425 | None |
| A0A3F2RN54 | 1-400 | None |
| A0A6A3N098 | 2-496 | None |
| A0A6A3V6Z8 | 61-430 | None |
| H3GIA8 | 3-384 | None |
| A0A6A3MF32 | 2-398 | None |
| H3GIG6 | 32-443 | None |
| A0A3R7KTC2 | 61-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.