DPCstruct | MC40422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 212 ± 51 aa |
| Standard deviation of domain lengths | 51.35 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 24.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4ZT86 | 64-234 | ALQLSCDKIPDDVFAATCSALSETHRQTKLILLTVRSINPLRWAWLVYALYYRAWNGVEDTDFAESNLRITNIKLTRADVDSIEAAL… |
| G5A8J8 | 2-161 | CSAMVHTRTTQKLALELEINPGDRTNRNHWWKWLAYALFSMRARACSSLRTLIIPFLGELTGVDVRAFTSVLTSEHPEETLYDTPRG… |
| G4ZSX3 | 2-174 | None |
| G4ZSY5 | 174-391 | None |
| G4ZT66 | 219-385 | None |
| G4ZT84 | 2-172 | None |
| A0A833WYF4 | 177-355 | None |
| A0A6A3U8L5 | 275-586 | None |
| D0N0X7 | 312-536 | None |
| W2PNA6 | 79-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.