DPCstruct | MC4042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 428 ± 36 aa |
| Standard deviation of domain lengths | 36.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.64 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0487- CL0238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813LFG5 | 150-599 | PLDFEAARCLHAASASSEALASQPGDAERIILRVNRAAHPFAALGLTAVGTQGGVPVARQALADCEELLAPAKANPALRAAAEAASA… |
| A0A7S0FCC4 | 1-405 | RAANPFAALGVAPADLRLGAAAIRRTFRRRSLIVHPDKVDEALRKHAVAIFAKLEASASAVEAMLQVDLEATVLLAEVDAAHDAGRL… |
| A0A812GWG3 | 468-933 | None |
| A0A812JIL8 | 2-344 | None |
| A0A1Q9CAQ5 | 472-882 | None |
| A0A812X8E8 | 376-809 | None |
| A0A7S2Q391 | 400-827 | None |
| A0A7S4UFB4 | 1-483 | None |
| A0A812NWP5 | 645-1078 | None |
| A0A7S1A5H9 | 297-726 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.