DPCstruct | MC40419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 229 ± 33 aa |
| Standard deviation of domain lengths | 33.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3L737 | 2-224 | CVLVGVPTVLIDTQTRILMVGTQTNTLVMIGTIGMAVVEVCTRSAKALAIIWTIRRQAKAVDEKLHQLSANTMQAEVARHMKRSPSS… |
| G4ZJU3 | 1-251 | MESSGIVLSSFVAASVVFKLFIQESTKHYIIKKRIRSVRFMCAAVALPTVLIDTQTRIILLGTMNSKFVAVGTIGMAFVEILLRVGK… |
| K3WIZ5 | 113-363 | None |
| A0A833TCC6 | 1-182 | None |
| A0A833T6W4 | 138-420 | None |
| H3HDC3 | 72-276 | None |
| A0A2P4YTX6 | 874-1126 | None |
| K3WDT4 | 184-438 | None |
| D0NSC9 | 124-317 | None |
| W2KHS5 | 3-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.