DPCstruct | MC40416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4ZDV3 | 98-174 | EAAPRRLQCVAWRATGRCRPNGPREPQNDKKCSDFIVNGMSGFCEVEDIDTGERIQVMQRHCTSLKGDVKFRCSDAP |
| A0A6A3NNT7 | 37-108 | EFQCLGWVATDDEGDELGLRRGCWQRIQAGDAGYCEVLNTTSGQVFHVMHTTSLSLKDDARFTCELAKEFSS |
| W2JS51 | 106-164 | None |
| G4ZDT7 | 379-455 | None |
| G4ZDV5 | 2-92 | None |
| A0A6A3TZ27 | 98-191 | None |
| A0A6A3TZ36 | 126-207 | None |
| A0A7S4QUV2 | 362-457 | None |
| A0A418AW61 | 26-97 | None |
| W2PDU3 | 100-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.