DPCstruct | MC40413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 157 ± 16 aa |
| Standard deviation of domain lengths | 16.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3FFF9 | 160-301 | PPLQLRKPPQLTPRFSWTAEGDAIVVGTSEAGNSTIKLQQQVNGLNWDVVAQENAEKDVKKLTKHPGGIVFHANPRIHGYPWQAPER… |
| G4ZBM5 | 8-161 | GASSVLVTLRHEPNLSAPYEWRRIAPETVKGVPRMGAAAEGAITLLQEPDGINWSDASVHGNREVDRDGADMAEYAANKGIVIEATP… |
| M4BC86 | 6-161 | None |
| M4BXD9 | 19-146 | None |
| M4C229 | 93-249 | None |
| W2X796 | 96-277 | None |
| M4BTR5 | 198-366 | None |
| M4BHD6 | 129-280 | None |
| A0A6A3SML3 | 1-141 | None |
| A0A329RCA0 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.