DPCstruct | MC40410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849T2M9 | 7-68 | SHYLLATDGSGYFRSEKLVCDCCMIEEHFDENNKMTLKFGHNILAGSIVHPDLKQVIPMCLN |
| A0A0K2LX93 | 25-75 | EILIALDGTEYFSSKKISCPHCNFRNHRNGTTTYFHGCVTPIVVSPNQKQV |
| A0A849T821 | 2-72 | None |
| A0A849TC58 | 2-72 | None |
| A0A125NX45 | 32-100 | None |
| A0A6N1Y839 | 136-203 | None |
| A0A2G2DMQ2 | 2-66 | None |
| A0A8A3NT06 | 1-70 | None |
| A0A6L9GSF4 | 101-170 | None |
| A7BWF5 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.