DPCstruct | MC4041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 173 ± 16 aa |
| Standard deviation of domain lengths | 15.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813HQV5 | 614-761 | GNDNFEKLPPAASAVLPEDAPPGHEAHAHVRFDRSFSRALFKFDGVNFQATKKGAADSQYAAEVIARACYVKFAAGRPKEEVVDFRQ… |
| A0A7S0FAH3 | 1-173 | MSHHQSVEGASGRKDFMTCDFMALGVAAGDVPGALEQEEDAPQGHPAYSRVRFCDHPQGHLYHFKYGDEHFQVTLGRACNSAAHAAR… |
| A0A7S1WGJ0 | 393-552 | None |
| A0A812RSI6 | 144-310 | None |
| A0A813GRV9 | 104-300 | None |
| A0A7S1Q246 | 27-222 | None |
| A0A1Q9F7P6 | 275-456 | None |
| A0A813E9R2 | 304-475 | None |
| A0A7S1A6P7 | 21-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.