DPCstruct | MC40408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 180 ± 34 aa |
| Standard deviation of domain lengths | 34.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287QJL1 | 18-189 | LAHLVEAEMIKRTKEGRYKGKKFSSVCHFFGYQARGSLPSNFDCDYAYVLGHISLHMIAAGLTGYMATVANLKDPVYKWRCAAAPLT… |
| A0A7X6QLQ5 | 5-135 | KFATQTHFFGYEGLCTAPSNYDADYCYSLGYTASRLIAYGKTGYMSSVRNTTKAAKDWIAGGVPITMMMNMERRHGEMKPVIQKALV… |
| A0A453PE81 | 2-162 | None |
| A0A7J6RA35 | 4-152 | None |
| A0BGI3 | 3-183 | None |
| A0A7G2DS38 | 383-593 | None |
| A0A1D6NDB2 | 32-231 | None |
| A0A813H1N0 | 364-540 | None |
| D8M522 | 32-227 | None |
| D8M1Y4 | 11-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.