DPCstruct | MC40401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 134 ± 23 aa |
| Standard deviation of domain lengths | 23.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287Q807 | 17-134 | PLPDHFPPVSAVTPWGLLIKYFLRVDAGGLFHTYPHRGGPFKTLQEAQDAIDSYHTNLCKFKYLGELSNEDRYVWHKLYWRNGTRKN… |
| A0A446LM34 | 6-105 | RVDHGGSFHTYPYAGGPFQSLDEADKAMDRYFLEHRDPKLLMHQGGVSSLEMAIEAALYWPDGARKRSKSDHAERARNGRRRLLQAL… |
| A0A287Q877 | 86-237 | None |
| A0A0D3H1P7 | 470-626 | None |
| A0A453DNF9 | 217-356 | None |
| A0A1B6PGQ4 | 35-129 | None |
| A0A453SQ45 | 203-310 | None |
| A0A835FA01 | 163-292 | None |
| C5Z3E3 | 29-185 | None |
| K3Y1S8 | 177-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.