DPCstruct | MC4040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 85 ± 15 aa |
| Standard deviation of domain lengths | 14.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2XFI5 | 230-299 | YDVVHHSWLTDCVREGRLLPLEHRHVLFAKPETNAELERRMDDYGDHYTQACTVASLKEVFSRIPSRKRQ |
| A0A1A8HAZ0 | 447-522 | QHDVVWASWLVACLDQKEVVPWQPRHMIHMSPSTREHFAKEYDIYGDSYFVDTDEQQLREVFGRISNVNAARCTSL |
| A0A7S3H454 | 206-317 | None |
| A0A4P9YAZ5 | 261-333 | None |
| A0A3S5APQ6 | 16-109 | None |
| A0A671SF17 | 409-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.