DPCstruct | MC404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 179 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1IYK1 | 1-148 | MRGSKTINIIELQKKFAAIQSELKKALDLVESKSFSSSFNVLANLTEYIVENCEDLGLALENAPFDGFDAPKFWRTLNQCWIFALEQ… |
| A0A0D2AAE8 | 41-228 | STGSMPRGMGRLLHPLYPKPEFKNYSVIDAYPNELVPVNHIQRDTADDWGWQCYHGLLRSAFAAIEAGRVKTARTKMLVASRWLVDA… |
| A0A261Y5C0 | 1-173 | None |
| A0A0C3CZ81 | 160-336 | None |
| A0A093XY61 | 27-196 | None |
| A0A6G1HJ81 | 4-182 | None |
| M1VXD2 | 185-353 | None |
| W9WRA7 | 1-162 | None |
| A0A7R7ZYV6 | 30-207 | None |
| A0A0G2HYL0 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.