DPCstruct | MC40396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 463 ± 29 aa |
| Standard deviation of domain lengths | 29.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3KFF0 | 173-626 | ASAFQGVPVRDYVTDGVALVLLLVTLGLGWDFRYAASERIEVVLVTVVSILSLSLFYLARSGALPRGWTNRTVLTARALANVPFVLL… |
| A0A318RH37 | 1-430 | MRQLIPGAIPTRADRTRDVLAAVALLVSAALEWNADTVGAGRIDVVAVTALSVLSLVLPAASRRGVFGPRWTPARLRLAKVLLGVPY… |
| D1BEZ6 | 11-451 | None |
| A0A1A3JHD2 | 1-491 | None |
| A0A839QJT4 | 28-478 | None |
| A0A6G9CM64 | 1-461 | None |
| A0A4R9AFA2 | 28-537 | None |
| A0A5B7R6E2 | 102-599 | None |
| A0A7D6Z6W2 | 209-622 | None |
| A0A0S2LV68 | 42-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.