DPCstruct | MC40391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 4 aa |
| Standard deviation of domain lengths | 3.85 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T0K408 | 99-186 | LDWLRRQPLMVEETIDARRTVMTHAGVLPGWTLNQAAALAREAEAALAGDACREFLGEMYGDTPDLWREDLSGIARLRCIVNVFTRMR |
| A0A7H4M068 | 100-184 | NWLRRQPMMQIDEEKKLVMAHAGITPQWDLETAKQCARDVEAVLASDSYPFFLDAMYGDMPNNWSNELSGLARLRFISNAFTRMR |
| A0A6G0Y0T9 | 402-487 | None |
| W1HSN6 | 227-311 | None |
| A0A1A9UKM1 | 65-152 | None |
| A0A090QVQ3 | 1-77 | None |
| A0A2X2DPK7 | 1-78 | None |
| A0A7R8ZU77 | 104-192 | None |
| Q4W573 | 100-182 | None |
| A0A376MQK8 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.