DPCstruct | MC40390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A220VC34 | 2-80 | FFSSKVRTLGGGNCSSIVIKSFIKKIINTENHDKPFSDIQISSILNKQGLKVARRTVAKYREEMGFLSSSMRKKNYKLT |
| A0A1V5JXJ4 | 62-149 | KYMMTPLGLFPMKFFFTSALKGTGGEELSSLSIKERIKRLVEGEDPGRPLSDDKLTDILLSMGVKIKRRTVAKYREELEIPSSLARKK |
| A0A3R8LQR2 | 578-656 | None |
| A0A3S0A6C2 | 489-568 | None |
| A0A7V3VA94 | 151-238 | None |
| I2NP69 | 80-168 | None |
| A0A1V5FM08 | 456-535 | None |
| A0A355VHQ5 | 137-233 | None |
| A0A800K766 | 5-85 | None |
| A0A535FPF8 | 63-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.