DPCstruct | MC40386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 817 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 17.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.93 |
| Pfam Score | 61.89 |
| Assigned Pfam label(s) | CL0023- PF11987- CL0526- CL0740- CL0437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542ZXE8 | 97-202 | TAVTPRTVPAATGSTDGGSAHGFSLPVDDAFTIAGRGTVVTGTVASGQVRGGQSVTLHRGPAALGTYRITGIEAFRKRLDTASAGDT… |
| A0A6J1BMD8 | 1-119 | EAVFPCVLKILPNCIFNKKDPIVLGVDVLEGIARVGTPICIPQREFIDIGRIASVENNHKPVDVAKKGQKVAIKIVGSNPEEQQKMY… |
| A0A401FI79 | 129-221 | None |
| A0A1E3C1M3 | 45-144 | None |
| A0A5E7QRD8 | 381-472 | None |
| L5JNJ0 | 79-188 | None |
| A0A378B6Z4 | 2-97 | None |
| A0A2D0Q7Y8 | 277-374 | None |
| A0A7S0VU48 | 23-129 | None |
| A0A351YC71 | 550-642 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.