DPCstruct | MC40382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 197 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2B1X1 | 2-194 | MTHEGFAYWDGDLPTDLADDLFTALVAIFEVASGSEINQIYKLSDSGYVFGVFSGIQVDSSITNMLTILSTPIVDENGINNYFYLES… |
| Q707V6 | 11-205 | TLVSSQNIMFGYTGGDKIDIHKKQALASISEFKSLLNNFDQRQSFKYQKDDIAAFVWSGSMVDNKDFSSNLISVLTDEVNEYGIPDE… |
| A0A2S4LAS4 | 113-331 | None |
| A0A318YKJ9 | 39-214 | None |
| A0A162LXD7 | 164-400 | None |
| A0A6A5V0T5 | 1-200 | None |
| A0A1B8EWV0 | 87-308 | None |
| H2AUW5 | 24-213 | None |
| A0A5N6XCF2 | 100-260 | None |
| A0A0A2JFC6 | 329-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.