DPCstruct | MC4038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 187 ± 26 aa |
| Standard deviation of domain lengths | 26.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497YUN3 | 12-214 | AVLLAGCSEDKVEQTGTDSPNASEQGVEVEEVEIPEYSVLEMDVFEDAGIIRRDYWVLPDDIFICEEQIELLITDAVNQAGDDGPYN… |
| A0A661VLH4 | 4-165 | LADVVLEKEEALSDEQLIHIAQQVVNSIISAKKVNAIGVFFWGPESSVGQGIAAASVDWAPEGRWEKADAVETGDYSRHRFRVDFNR… |
| R5IDM8 | 1-161 | None |
| A0A6B1HE06 | 90-267 | None |
| A0A0F5RVX4 | 265-424 | None |
| A0A2Z6IET4 | 26-210 | None |
| B6WRT5 | 15-203 | None |
| D5EFD4 | 166-354 | None |
| G1UYR8 | 126-316 | None |
| A0A2S7KXP1 | 7-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.