DPCstruct | MC4037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 137 ± 24 aa |
| Standard deviation of domain lengths | 23.70 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G8R6V2 | 385-502 | KTADSAMLPAYYVVPRAWREVAYRLQLNGVIMEPLKSDTIINVNSYYIQNPKFSNYPYEGHFPLRDMEVEIKYQQRAFLAGDYLVPT… |
| A0A0C4EBC9 | 18-151 | STVPSVANLTRARPEAYLIPRTWGGAVVERLRILGVEVETLDRGYRGAVDTLTVATSSLARSMYEGGHVLNTVTTTPGRREVVLPPG… |
| A0A1V5JTJ4 | 183-324 | None |
| A0A7X5WC71 | 25-207 | None |
| A0A0N1HB58 | 398-543 | None |
| A0A5Q3DWH0 | 392-542 | None |
| A0A415DVZ6 | 430-591 | None |
| X1HIJ6 | 97-214 | None |
| A0A0G4N7J1 | 786-933 | None |
| A0A3M9YEM0 | 220-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.