DPCstruct | MC40364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 111 ± 24 aa |
| Standard deviation of domain lengths | 24.06 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662V4X5 | 10-109 | SKYGAVIIEELHTSLSTKERKEIAYTYYTLGQGFKVAVEVTLIATDNEVVNIGDEVIVIGGTTEGADTAIIVKASIISNMIGPDINK… |
| C7NPD0 | 122-248 | VGHSYGFDEPNEQELDAEHVETIEAADGDVFVGPMAFSNVGSAVSERDGYATHEVIADVLRLFGQGTKVAVECPLMACDAGLVDSGS… |
| A0A0W8F467 | 1-93 | None |
| A0A645I6U1 | 29-148 | None |
| A0A7C3C0D7 | 54-214 | None |
| A0A7C6QX09 | 67-212 | None |
| A0A0S7XJ59 | 102-194 | None |
| A0A842YMU2 | 8-123 | None |
| A0A522W9M7 | 34-172 | None |
| A0A5E4KY03 | 5-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.