DPCstruct | MC4036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2TQE2 | 18-113 | FCFGCEFEVMIRPKTTSGLQLPPDASSVSEQRRFNFRLLDTLARVMTGAGLESAVFDAAEQEKPDYSKWNMMLDGSLSKRHIPDGFY… |
| A0A0C4EAR7 | 1-102 | MASSRLFYFGVEIELLMGSKKSKHSTWKSLAAEVAKKLAKAGIDNHINESGDKSPEVYTKWSIAPEVTIPGQPAKGLCNIPPLLPLE… |
| A0A4R8QES6 | 1-85 | None |
| A0A225AQT3 | 37-120 | None |
| A0A0G4LXM4 | 1-85 | None |
| A0A4R8PY77 | 1-91 | None |
| A0A5C3Q877 | 1-99 | None |
| A0A1V1TFE0 | 1-93 | None |
| A0A2T4A520 | 56-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.