DPCstruct | MC40354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 444 ± 69 aa |
| Standard deviation of domain lengths | 69.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.42 |
| Pfam Score | 67.76 |
| Assigned Pfam label(s) | PF12430- PF04791- PF14777- PF04906- PF12537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R0H6P1 | 94-536 | LFLWRFLYWTLFFLTWVVLPIYSEYVESGHLSRKLKLKQAIRDHVKLKLTVGVFLLLALFVIAAKGYLNMHNFTAFAMVAANSWGII… |
| A0A0L0DN76 | 33-473 | DANTAWFPKAVVVLGFSAAALSVLLLPLDVANRNSGSTLDMLLFVYIVYPLVAFLALVVIPFAMFYYEAEEAENNSKSKQLYSALCY… |
| A0A0V0R074 | 39-469 | None |
| A0A5P1F7T4 | 282-737 | None |
| G0QZB4 | 4-421 | None |
| A0A5B7FJX2 | 13-447 | None |
| L8Y929 | 384-814 | None |
| A0A6S9A202 | 63-514 | None |
| A0A2P6NQ14 | 40-537 | None |
| A0A1Q9EKD1 | 417-833 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.