DPCstruct | MC40352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 74 ± 11 aa |
| Standard deviation of domain lengths | 10.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02953 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2VKY4 | 3-82 | QAQLQMVADLEMEMMSDMYRRMTNACQQKCIATSYKEGDLTKGEAVCLDRCVAKYLDVHEKLGKRLTTMSQQDEKQLQQM |
| A0A1R0H1B0 | 21-96 | NGYANQQAQLAAAEQEMDMISDLFNRLSDACHKKCIINKYPDSDLTKGESVCIDRCVSKFFQVNKEVGDVLAKLSE |
| A8JHD2 | 10-79 | None |
| A0A098VRC0 | 4-77 | None |
| B6AAF8 | 1-78 | None |
| A0A1A6A2V3 | 2-75 | None |
| A0A540M5I7 | 88-154 | None |
| A0A835UKK3 | 49-105 | None |
| A0A058Z715 | 11-85 | None |
| A0A0L0T6L3 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.