DPCstruct | MC4035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 110 ± 16 aa |
| Standard deviation of domain lengths | 15.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9M312 | 215-303 | LLQTIAQITGLRLPDHKMSNANTLADIRHMLLAKPKSRTFAEANKAQFEATPNVQIRDKRQTRIDKDEAKGKWKLIVKGLQERGLPV… |
| A0A0C4E1M2 | 30-133 | AIAKRVHQLSGHILVDSKLNSVQTINDLIKILVTPPKPKKLAEEIEARGELAKLPNVTVYNRRVTPIDKDKMVGRWKVVAQELEKRD… |
| D4ANK2 | 665-770 | None |
| G2XZB0 | 385-486 | None |
| A0A2P8AE38 | 19-149 | None |
| A0A3M7DIB7 | 9-114 | None |
| C4JJ20 | 111-214 | None |
| K2SEB1 | 208-299 | None |
| A0A7D8YNY2 | 217-346 | None |
| A0A1W2TSG6 | 333-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.