DPCstruct | MC40344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 200 |
|---|---|
| Mean domain length (aa) | 143 ± 31 aa |
| Standard deviation of domain lengths | 31.37 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01025 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6KMN8 | 136-284 | RKTNGEATEQPEEDITDVEQVESARDYAISGFAKALLDVGDSLTNARQQLQQQLEKQQQQQQQQQSVGQLQQFVDGISMTESLFHKT… |
| A0A1E1J1L5 | 4-74 | EEVALKVLKRYGVTQMNTVVGAPFDEAKEEKIFTVPSTLSLQEGSVAEIVKKGYHMNESVLRRAEVGLSED |
| K2AZ90 | 53-232 | None |
| A0A2K2VVR3 | 6-121 | None |
| A0A351CHG4 | 8-121 | None |
| A0A136LBJ1 | 27-177 | None |
| A0A3M1BWX6 | 8-94 | None |
| A0A518HIT2 | 108-258 | None |
| A0A833L291 | 79-224 | None |
| A0A2G7D2C7 | 509-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.