DPCstruct | MC40336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 49 ± 3 aa |
| Standard deviation of domain lengths | 2.77 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2PDM1 | 4-51 | LDQIMGVKEAGELWGLSPDRVKGLCQAGDIEAKKIGKTWIIFKDQPNP |
| A0A2C1ZBH6 | 3-50 | LDKVIGVEEAAVLWGLSPGYIKNLCAKSEVVSKKIGKTWVIDATQNHP |
| A0A0Q9JV98 | 39-85 | None |
| A0A4Y3PK80 | 1-52 | None |
| A0A243DBH5 | 1-52 | None |
| W8YEJ1 | 70-115 | None |
| A0A7W3NHJ8 | 73-123 | None |
| A0A2B0BRP1 | 3-52 | None |
| A0A2A8GZ98 | 12-59 | None |
| A0A1Q5XM36 | 103-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.