DPCstruct | MC40335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 14 aa |
| Standard deviation of domain lengths | 14.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 35.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A252E4Y7 | 106-260 | IAPQLTTVEINFYHHEVYINKQFIAYIAYDIDEFVMQPWLVMVNGKEIFRGTTSAKCLRYIQWHYQDGTLNPSNQVELAEVPEVPTI… |
| A0A2R5FYL8 | 1-163 | MLPDELIASITHDDDLTQPWVVLVQGKEKFRANTYARCHRFIQWHHQDSTLNEPTQVETPPTTENLIMAHIFNECQNYGFEILDDGI… |
| A0A6G9SCS7 | 35-193 | None |
| A0A0M3V6J2 | 47-212 | None |
| A0A2R5G5P5 | 1-202 | None |
| A0A1Z4UG27 | 154-312 | None |
| A0A2Z6D265 | 78-261 | None |
| A0A841WMS5 | 4-164 | None |
| A0A367RYZ9 | 52-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.