DPCstruct | MC40324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 338 |
|---|---|
| Mean domain length (aa) | 256 ± 45 aa |
| Standard deviation of domain lengths | 45.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.34 |
| Mean intra-cluster sequence similarity (%) | 13.26 |
| Pfam Score | 47.68 |
| Assigned Pfam label(s) | CL0369- CL0287- PF20597- PF11999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6AIM3 | 23-268 | RANADVADVVPQLGDLERWTTFSLGSGNRPSLAVGHLFIDGDLGFAGAGNFLIGGHSNVAGDVYVPSNGTVLAIDHAVFTGSIFDNQ… |
| A0A2N1UPR3 | 2-172 | DASNTFAKSPMVTGRIYAANLTPPTPTKMTTAIGDLATAYTDAAGRAIPDFAELGTGQIGGLTLVPGLYKWGTNVLISTDVTLNGGP… |
| A0A1F3IW73 | 69-294 | None |
| A0A0B8NYT5 | 2-294 | None |
| A0A416IC67 | 19-241 | None |
| A0A535A6S0 | 3-311 | None |
| A0A7U4E8G8 | 78-371 | None |
| A0A7C4LWP1 | 122-416 | None |
| A0A1X7NRP6 | 95-316 | None |
| A0A1G1AH90 | 154-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.