DPCstruct | MC40312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 110 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.61 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF11535- PF13817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6VVN0 | 8-118 | AEREHRIEMEIVVDAYTEEERAMSWYCYLEEQLSFPFKASVRKPMDSSPLPTGEHVCVTGLAHEDLCRVGIFVWVRWKERDVVAPLA… |
| F4F8D1 | 2-91 | IEEATVDAYGDDEQLTGLFTMIEEHLAVPFTTTVLGVEVTVRKIDLTADTIVALCARGHHRQRIGLLDLPLPTPPPDGAGWIDAYRH… |
| A0A1F8V793 | 6-108 | None |
| A0A536ZSP1 | 14-108 | None |
| U3UAI2 | 95-193 | None |
| A0A2M7QXK4 | 148-255 | None |
| A0A7C2Y7X1 | 23-144 | None |
| A0A849T467 | 15-132 | None |
| A0A8A9EUH8 | 233-358 | None |
| A0A7C7QSX1 | 238-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.