DPCstruct | MC40311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 132 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842LQF6 | 218-338 | REAKVRDFISRLRGYVNIIGPDPQHRRDKFFMLRRAILLRSMFERKTPHLFDASGRLRIDEGVLNAFLMIPEYRHGVRSMEAILDMS… |
| A0A5C6V6H1 | 64-224 | ARPERNRCRISRTASSTEKKGEQPAGDAAQQQPNDEDEEAKRAKLPDFVSRLRGHLDVSGVNPPESPDGKLAPIDRMLLLRRAILLR… |
| A0A6A5U182 | 228-356 | None |
| A0A1E3BHW3 | 115-240 | None |
| D9PWL1 | 24-168 | None |
| A0A1F8PVG6 | 3-121 | None |
| A0A1I6KMA4 | 353-472 | None |
| A0A6N7XGE6 | 126-245 | None |
| A0A017SKE3 | 570-685 | None |
| A0A849QHB8 | 76-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.