DPCstruct | MC4031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.74 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0431- PF15233 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4KND5 | 3-79 | LYHQLHASVHAKHSAMRVLHCVSDEATSLAWVTPIFEFYCVAGPNVSRATITQGANKIIQWAKREEERIFIIGGGVF |
| A0A0C4DRV7 | 19-114 | SSLDEPAFADVVARRRLSTLYHRLHASAHARHSHLRVLHCSGEDSTSLAWITSVFEFYCVAGPNSSRAAMSQGANRIVQWAKREEER… |
| L9KKJ8 | 632-747 | None |
| A0A1I8IQP4 | 927-1020 | None |
| L0PCF9 | 2-94 | None |
| A0A0E9NJY3 | 405-515 | None |
| A0A6V8QJ27 | 342-432 | None |
| A0A6A6HXS7 | 979-1069 | None |
| A0A3Q0FRN2 | 505-588 | None |
| A0A6P3WUT6 | 716-804 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.