DPCstruct | MC40306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317QIH8 | 64-119 | RSARMFPVPTAVNSSGTAFMEAHIKVQRRGGLAPRIHYVDDSQQSGMVYVGYFGRH |
| A0A7X7NQT7 | 1-74 | VESNRRLAEQRRFPVDTQVDPAGTTIMWSHLKIAEGGGRLAPRIYFHDDTRGVTGRVHIGFVGPHHYTENTKTN |
| A0A7G5LRZ7 | 437-504 | None |
| A0A124IFA7 | 175-238 | None |
| A0A857L927 | 336-399 | None |
| A0A066YYA2 | 281-349 | None |
| A0A193BV21 | 1-66 | None |
| A0A0F4JHM4 | 195-262 | None |
| A0A1X7CY02 | 1-59 | None |
| A0A428YBW7 | 296-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.