DPCstruct | MC40305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 167 ± 21 aa |
| Standard deviation of domain lengths | 21.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L8LHT5 | 45-213 | ARKFVMPAMAGDVDAALSLSVAVGNKRRGQVVVAFWRAKVPRESFRALLSSVWDHDHNELITAARTRRLLRALFRYAQFDTSILPGT… |
| A0A853CJZ5 | 11-183 | WLALLGAREVHRHWQQQRSTPLPDALAALRGLFALAEAGELRRGAARAIVVGAWALLAPRPTQAVPVELWRALFSITGPCIDEEEWT… |
| A0A351MYX8 | 37-220 | None |
| A0A225TE30 | 5-150 | None |
| A0A416WAK3 | 12-199 | None |
| A0A1N6JT94 | 51-220 | None |
| A0A6G7XCU2 | 52-219 | None |
| A0A371X5X1 | 11-162 | None |
| A0A845UPD0 | 65-251 | None |
| R4K8B6 | 61-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.