DPCstruct | MC4030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C4DQJ6 | 1-88 | MCGRAYSPRFLWMWPNARVGVMGADQLAAVMETVGKPDPELRDRIERESDAVFSSARLWDDGVIPPEHTRRYLGLGLAAALSGRNDVK |
| A0A147GMJ0 | 1-91 | MGGEQAASVLATVKRDGIESRGGQWSKEEEEAFKAPIRQQYEDQGHPYYATARLWDDGIIDPADTRRVLALGLAAARHAPIPEPKFG… |
| A0A081SDI2 | 1-113 | None |
| A0A4W3GBL2 | 4-89 | None |
| A0A010S2I2 | 378-480 | None |
| A0A238VA33 | 589-678 | None |
| A0A6M6JF25 | 1-102 | None |
| A0A2V8I8A5 | 406-503 | None |
| A0A645CDS6 | 259-360 | None |
| A0A6J6QLH0 | 116-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.