DPCstruct | MC403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 163 ± 24 aa |
| Standard deviation of domain lengths | 23.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S7FZ97 | 22-177 | EFSIPYMMLLTYNQIIEVLLDKYGEVPGNYFLDQQCTKVNEYIKRSSEGLQIHHIKENEMKGLSNPEFARKAPFSYQMEYNLVYCNL… |
| A0A330LEI5 | 12-117 | LDLSYIEAVKLLLVKYGPSVDDYFREKSYERFLNGEILNILKGNTSRSKEGLFCHHIDENKYLSLGKKEEVRRQKAPFSTQRQDRLV… |
| A0A6P1YAU7 | 11-189 | None |
| A0A1G5IWS2 | 3-158 | None |
| A0A0R2CIY7 | 8-196 | None |
| A0A844R0Q4 | 13-196 | None |
| A0A7X6WVW7 | 6-171 | None |
| A0A6G7ZBK6 | 9-148 | None |
| A0A1V5GP43 | 9-169 | None |
| A0A4R6BCH9 | 4-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.