DPCstruct | MC40297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3UG00 | 3-106 | SRFPTAYSILFLLIILMAGLTWIMPAGKFDREMNEAVGREVAVAGTYHEVEPNPQGIVEVMLAPGAGFYDPDSYAANAIDVALFVLF… |
| A0A3B8ZN48 | 1-95 | MKKRQIPHTFTIVFYIIIFCALLTWFVPGGKYVEQIAPNGDKTMVYQQVESIPQTWQVLSAFFEGFVDKADIIIFILIIGGAFWIVN… |
| A0A380VC09 | 1-119 | None |
| A0A7X9K9Q1 | 2-112 | None |
| A0A1L8WXX6 | 4-116 | None |
| A0A416AM16 | 5-110 | None |
| G5FF54 | 1-116 | None |
| A0A1G7FR99 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.