DPCstruct | MC40296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 205 ± 26 aa |
| Standard deviation of domain lengths | 25.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 75.74 |
| Assigned Pfam label(s) | PF19295- PF01458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3UFV0 | 5-190 | QQTALELAAEQQTPAWLAALRQQGASTWAAAAWPGRKTEHWKYISLAPLQQCEQLGWSSESDDVALDAVEQIELDAIRLVFVNGRFN… |
| A0A447KZY4 | 11-208 | RALQTLYSLFEAHGGEQSAYALAHWQQALRLGWPTRKHENWKYTPLEGLLERQFVAPIVSDITAAQRDALALDIDAYRLVFVDGRYS… |
| A0A535T5Z3 | 6-218 | None |
| A0A0R0HCK9 | 3-269 | None |
| W4SH11 | 198-406 | None |
| A0A178IIA4 | 127-372 | None |
| A0A381GMS1 | 9-189 | None |
| A0A1F2P3X3 | 3-166 | None |
| A0A1B0C170 | 29-237 | None |
| A0A2U1QG26 | 220-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.