DPCstruct | MC40295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 337 ± 61 aa |
| Standard deviation of domain lengths | 60.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.45 |
| Pfam Score | 85.32 |
| Assigned Pfam label(s) | CL0208- PF21713- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3UEF1 | 1-379 | MGVLVDQMDTSLQRGIAALRGALGEDAAHALLQPAAARSDEAASYYFPLPVDYTGMERRLRISFPKSFPRGGLRLTVEPSPWLVWPH… |
| A0A0P7GKX0 | 14-321 | VADDVELVLTAAQVAQLRDWTLQDDGIERFAYIYCEPQHGRLLAREIDPIPAEDCAVMESSAVRPELAVERERLGAAMEAGLVPIMV… |
| A0A839P7A7 | 10-351 | None |
| A0A518HSV8 | 11-457 | None |
| A0L5E1 | 11-416 | None |
| A0A495W106 | 3-274 | None |
| A0A1E3VNX4 | 1-324 | None |
| A0A177MMR7 | 3-329 | None |
| A0A2B8JC83 | 10-375 | None |
| A0A354GWY9 | 1-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.