DPCstruct | MC40294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04608 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3UBL6 | 1-105 | MTDAHETTPASVWRNPIHFLAFGFGSGAIRPAPGTWGTLAALPFVLVWQQLPVAGYGLVIVLSTLLGIWLCHRTAADLGVHDHGGIV… |
| Q2AC37 | 600-704 | RRASAAFMRSHPAHWIALGFGAGLSPRAPGTVGTAWAWLAYLVVQHWLSPLQIGGLILAGTLVGWWACTTTARHLGVADPGCVVWDE… |
| A0A6N8K710 | 7-118 | None |
| A0A8B3SZZ0 | 1-108 | None |
| A0A388PWE8 | 311-429 | None |
| A0A2X1QQH6 | 1-121 | None |
| A0A2N7QZI9 | 6-118 | None |
| A0A5B9DZV0 | 6-117 | None |
| A0A448QU00 | 4-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.