DPCstruct | MC40293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 61.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3U8P7 | 1-65 | DFDAIDEPLEPLQPVTGARVLAVFGDSITTDHISPAGNIKASSPAGEYLQSLGVEPADFNSYGSR |
| A0A2A8MFR2 | 1-75 | STYIRLSPFFDDMLAEPAPLKDIHGARILAMLGDSVTTDHISPAGSIKADSPAGRYLQSRGVERRDFNSYGSRRG |
| A0A447QV26 | 429-503 | None |
| A0A1D6EWX9 | 120-194 | None |
| A0A6P3ZFX6 | 242-316 | None |
| A0A6P6BZ23 | 640-714 | None |
| A0A379GI26 | 33-107 | None |
| A0A835LZF7 | 259-333 | None |
| A0A3P6RIY4 | 341-415 | None |
| A0A6A4IZ81 | 275-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.